DPCstruct | MC1365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 199 ± 40 aa |
| Standard deviation of domain lengths | 39.69 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9K716 | 430-649 | GLWVYLSETPTGFALTLTDEDGYAGGAQLDHAHQPATDATQADASLREHLARFGATIFAVNDVGLQLSQPWFIPASAVNALRRDALA… |
| A0A484ZPC6 | 46-248 | DNLLLRATSEENVFVTVSLKNDFDVANQADKALSSLKDGLAKLGQTIYKATAVRIDLPIVCFIPSAQLNQLRRDAIEALTEARVSHY… |
| A0A3M6R2I6 | 157-372 | None |
| A0A7X6QL15 | 2-153 | None |
| A0A447UFC3 | 12-120 | None |
| A0A380C9K0 | 144-369 | None |
| A0A7X8M821 | 4-153 | None |
| A0A0S2SLB3 | 23-171 | None |
| A0A378B432 | 26-207 | None |
| A0A0H3U7H4 | 82-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.