DPCstruct | MC13649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9PBM9 | 3-75 | SSSRSLVDPVSEKDIQNVLLSTGPIKAQELVANFKPRLQEKKDKDAFAEILKRISKIQKLNGSNYVVLKEGYK |
| A0A287PCG3 | 31-98 | RKETTSAIIEEEIIRVLRAIAPVRSQDFVLKFKDRIRTEEDKKHFHDIVMKFTYSHKTNNVSYLHLRK |
| A0A1U8PR20 | 199-271 | None |
| A0A835RRH0 | 29-109 | None |
| A0A5N5JPB1 | 382-453 | None |
| A0A1R3I361 | 1-68 | None |
| A0A0L9TT19 | 314-386 | None |
| A0A1S4AF13 | 129-203 | None |
| A0A6A6LQJ4 | 10-85 | None |
| A0A178V0V3 | 4-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.