DPCstruct | MC13648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 202 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A290RT83 | 158-365 | LEALYFPWISDNDSSGVTIKAINLEERIAKAPLFFMTFLKAAYSKDDEVNESFARLAYQVLSGVKRAPGVLDESSFCVKELEQWLKT… |
| A0A1I2T3M8 | 38-211 | IKLICGKEDDFSGLKEEKTRIVSQCYKLLYGWKRVPGMRMNGMLDTTVLNNWIAVVTAESKKYDVESMAFNYFGRAAFYAPIDEDGF… |
| A0A017T5X2 | 297-536 | None |
| A0A5C5BXJ3 | 898-1094 | None |
| C6REY0 | 619-829 | None |
| A0A2N8M7J1 | 33-233 | None |
| A0A540WQW9 | 341-555 | None |
| A0A5Q3L6H5 | 79-291 | None |
| A0A5Q3L2Q0 | 450-664 | None |
| A0A2I8EZF8 | 1030-1253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.