DPCstruct | MC13644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8N1X2 | 60-144 | QLLQSTAKWLAEDLSYDEYELDLYQPASSLYFCAAYLCWLKTYKSVTRSDEFVVRGYNGGPNGVNLEATVPYWNKYKQALETVLS |
| A0A2P5YL41 | 2-83 | GYRAYRVDYMEDLTNPFVSMYFGAAYLAWLSEYEGRERSLQFIFHGYISGPKNVHLEETCPEWLKFEQILARYERTKSREGS |
| A0A287TTI3 | 141-238 | None |
| A0A287TTH5 | 16-101 | None |
| A0A7J6W7Z1 | 327-439 | None |
| A0A2I0KAH4 | 85-178 | None |
| A0A2R6PKK1 | 383-477 | None |
| A0A7J8YIG4 | 3-90 | None |
| A0A1D6QSC6 | 16-109 | None |
| A0A1D6QSC0 | 214-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.