DPCstruct | MC13643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 120 ± 11 aa |
| Standard deviation of domain lengths | 11.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9XLY3 | 1-114 | MNLHDYVVVLKQSKGVVPEFINPKYADETKSKFKKPARVESLMQDFAQLFESDKYNVGGVVFDRYTYQPVKNMLSDGLDKIAHGASG… |
| A0A7S2WAZ3 | 76-188 | FNLKTYTETLARTGGVMGEFVNPKYKDDARVEFKKPTRLECMMQDFAKTMHEGTKVGFTTSASWIGYSPAKNSIAEGLKKIRAGVAP… |
| A0A0V0QEW2 | 345-455 | None |
| A0A2V2VGC4 | 249-379 | None |
| A0A7S4AWG1 | 185-317 | None |
| A0A7S2WZ55 | 9-146 | None |
| A0A7S3YVT6 | 152-260 | None |
| A0A812MR86 | 625-733 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.