DPCstruct | MC13642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 353 ± 41 aa |
| Standard deviation of domain lengths | 41.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 23.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446N8I0 | 1-355 | MADPLPLATFMLTHVDVALRGKTALNVSGVLGVAVSRNGTAPEMGPYVSPELKVWPGSTEMKILFEGVYTETGDGESVLCLVGEAVL… |
| A0A2P5YD21 | 12-348 | YGVHCNSVVHESKPADEEFNITPFPGRQNGYFSGGDKVLNNPPSHFYSPPESKTLLFETHHVFKTHADDVFMVEGNLIFQTSFSYEQ… |
| A0A834TIH2 | 19-371 | None |
| A0A287HQD3 | 1-348 | None |
| A0A1E5UX39 | 1-345 | None |
| D7LNL6 | 57-390 | None |
| A0A1E5UYE4 | 100-513 | None |
| A0A0D9X0S5 | 79-473 | None |
| A0A445EK74 | 5-300 | None |
| A0A5J5BJD9 | 551-888 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.