DPCstruct | MC13641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 142 ± 17 aa |
| Standard deviation of domain lengths | 16.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 48.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04432 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5YC64 | 13-173 | TGNDAAHLPKVDAYVLIRDYTRKGIINWVPDNVVIDTICNSQGNRQPFVMETVKADDNAKFGFFSLLKVKVDISLLHTRKGPSQPVP… |
| A0A0R0E8I8 | 1-144 | MGVPKHSGIGMTQHPQYVTVRNKRGREMLSLIEKLLEITPTISTGNRRPFVMETVKADDEAKLGRGPSQPAPKFIGSLLAFILNLVG… |
| A0A7J0E4V3 | 134-263 | None |
| A0A5J5C455 | 682-841 | None |
| A0A061SGL6 | 54-195 | None |
| A0A7S3F6I6 | 1-123 | None |
| A0A1R3HMW1 | 623-773 | None |
| A0A438DT96 | 144-268 | None |
| A0A6J5VV68 | 313-415 | None |
| A0A7C2KR86 | 104-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.