DPCstruct | MC13640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 413 ± 91 aa |
| Standard deviation of domain lengths | 91.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8KVL4 | 2-317 | QGIEDAKKKEAERDKPTDPKAAGFAEKVATQVIKNIQIKVNDIHVRYEDRTTNKEAPFAIGATLEGFSVLTTDENWLPCILDQSVEM… |
| A0A2P5YB56 | 13-439 | CLQEAESATLEAIAGSKLGNPSSGNSWLGSLIATIIGNLKITISNVHIRYEDCISNPGHPFASGVTLAKLAAVTMDEQGNETFDTSG… |
| A0A077YX84 | 42-468 | None |
| A0A2S2NI76 | 755-1197 | None |
| A0A2S7PN44 | 371-858 | None |
| A0A817E6W4 | 3-332 | None |
| A0A2Y9JVX5 | 14-394 | None |
| A0A813GRU5 | 35-445 | None |
| H3GE99 | 325-806 | None |
| A0A151NK44 | 12-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.