DPCstruct | MC1364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 163 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 57.10 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0020- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484ZJB7 | 2-176 | LEEYRKHVAERRAEGIVPKPLDAGQVAGLVTLLKNPPAGEEAFLLDLLINRVPPGVDEAAYVKAGFLAAIVKGEATSPLVSAEKAVE… |
| A0A6N8Q630 | 2-145 | AALVELLKNPPAGEEEFLLDLLTNRVPPSVDEAAYVKAGFLAAIAKGEAKSPLLTPEKAIELLGTMQGGYNIHPLIDALDDAKLAPI… |
| R1DPH4 | 32-198 | None |
| A0A098TMA6 | 1-173 | None |
| A0A812QR35 | 36-205 | None |
| A0A812RLG3 | 2-145 | None |
| A0A7J6ZE46 | 35-198 | None |
| A0A5W4L7L6 | 1-171 | None |
| A0A0B7IYJ2 | 484-626 | None |
| A0A375HDG3 | 39-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.