DPCstruct | MC13639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 134 ± 21 aa |
| Standard deviation of domain lengths | 21.44 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0357- CL0459- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4AD67 | 70-172 | GSKKVDGDILLQDGTTVLFGSPKSGFMVVYEPFIITTSCLDSDSKKLTRSIMKNLGAHVVNEYRSDCNLLVMNSISVTIKVVCALIN… |
| A0A2P5YA65 | 1-145 | MVDEMTQSCQVRIRDLSKYGTFINKNLSSNKKVHHFPNKQTSLEDGDLLSFGTGNATFRFSYVPLVLYICCAEASQMNHHLQDKVSS… |
| A0A5A8CVQ3 | 40-161 | None |
| A0A0J6YHZ6 | 75-198 | None |
| W9RAY0 | 13-170 | None |
| A0A0C9QGH0 | 34-175 | None |
| A0A433Q0G5 | 19-185 | None |
| A0A7J7PGS6 | 79-223 | None |
| A0A556V920 | 161-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.