DPCstruct | MC13636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.07 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4S4W8 | 14-86 | AELAQVLRSLNTTHRLPSQFVTKRVARNMGWQRGDSLWSTPALQGKSIGGDKFSNFERQLPAGDWREADLDYK |
| A0A3N0FS21 | 20-95 | TTQAANDVVDSLRTTGKLPSNYVTKQVAENNGWAGGKALNNYVSGGQIGGDVFHNTTNLLPSAPGRSWYEADIGLN |
| A0A2T7MGJ2 | 36-102 | None |
| A0A380PR32 | 379-445 | None |
| B7JTL9 | 1030-1100 | None |
| A0A2S6VQZ7 | 7-76 | None |
| A0A2E1V738 | 80-154 | None |
| A0A7G1QAT5 | 116-192 | None |
| A0A7Z7RKW3 | 210-285 | None |
| A0A0C4Y5L7 | 804-877 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.