DPCstruct | MC13634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 88 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K0IJH3 | 1-102 | MTCKTTAGCALVALVSTAAAKAECADAARRYMRELLASVESLDAIVEQHGVRTLTDLFYLQQAIIADGFVDHFPNESAIVEVVQVLP… |
| A0A2G3K5Q2 | 7-78 | PEGARLFFEELTASVESLRGIADHYGVNTLSDILYLQQAILKGETIEVWPGETEVGEVVGALPSADRWLKYT |
| A0A2S0N5S3 | 1-114 | None |
| A0A0D5V2V7 | 272-348 | None |
| A0A1I7KCC5 | 74-179 | None |
| D5WNR0 | 16-109 | None |
| A0A1Q8ILR5 | 45-126 | None |
| A0A848IJQ6 | 36-123 | None |
| A0A1I2HTC3 | 285-371 | None |
| A0A2M7MUW6 | 111-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.