DPCstruct | MC13631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9BIF3 | 15-107 | EDRLQEAGQFRVRLASVGNPDFGQNPRARKYGAKANHWLKVGSIAEASAACRKFITDNELGGGNWSGGDVQDEAGKVVARISYNGRA… |
| A0A2S7WY11 | 3-95 | LIKSKIFVALGSEVNTGKFEQYSTNAKFEELSKPNGLIYYEVKDLEEASSICRKFIQTYSLGSGNWLGGRVINEKSDFLARISYNGR… |
| A0A348W2Q6 | 2-74 | None |
| A0A126RLX7 | 89-167 | None |
| A0A231HHF9 | 268-368 | None |
| A0A246JXB2 | 57-145 | None |
| A0A524PWC4 | 12-100 | None |
| A0A833LTE3 | 9-92 | None |
| A0A0C1VU45 | 72-172 | None |
| A0A259MU54 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.