DPCstruct | MC1363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 510 |
|---|---|
| Mean domain length (aa) | 126 ± 25 aa |
| Standard deviation of domain lengths | 24.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 98.40 |
| Assigned Pfam label(s) | CL0111- PF00305- CL0063- CL0184- CL0487 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1GCB9 | 92-195 | NVLHYRASYIYFDGNKMSLEDINKKRAKIMAQYKQGYRFDALAKLHSMDISANRGGDLGWFPEGKMHPEFEEAIKNHNTNDIFTLDI… |
| A0A484ZGZ2 | 2-116 | EVNARHILLRPSVVMTDAQAEAKLASIAADIRSGKADFKDMARQYSEDPGSAQQGGNLGWASPESYDPAFREALMRLQKNELSAPVR… |
| A0A445CUJ3 | 15-112 | None |
| M1YZU1 | 2-94 | None |
| A0A4Q3JLC2 | 123-242 | None |
| A0A3B9FKH9 | 196-312 | None |
| A0A6P8BIF8 | 251-359 | None |
| A0A353NZI0 | 31-149 | None |
| A0A7S2VLK5 | 335-487 | None |
| A0A7S3G5C3 | 3-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.