DPCstruct | MC13628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 7.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A083ZZC4 | 3-77 | CSGWVTVQVGYYTEYVYPDGSKNHRAKAISFVRMDEDVFQQLYKAALNVLWNWILFRKFQSIEEAENIAAQLLEY |
| A0A128FJL5 | 19-89 | RKWVAMEAVFFRIVVFPNGAVKKEAKSISFAKMDDNEFSELYRASFNVIWNQILHKYFESEADAERAVNNL |
| A0A4Q5VPX4 | 121-196 | None |
| A0A3R9AJ38 | 36-110 | None |
| A0A1G0DMN3 | 34-122 | None |
| A0A1B9N5R5 | 76-147 | None |
| A0A068R147 | 83-160 | None |
| A0A1D7Y007 | 1-69 | None |
| A0A379D1C1 | 85-149 | None |
| A0A6B1J3D0 | 39-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.