DPCstruct | MC13625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1PUE2 | 2-69 | KPYPKNVWSPAGGWWSQPKAWKRNSVIVGLGTTVLTGFLFYKSAQIERRTSYPTDWVPSMLWAKQFKE |
| N1PUI7 | 4-88 | TQILRSGGGKVPYPKHVWSPAGGWYSQPANWKANTAVMGAVVAGVVALAWGYSAEHEFRNEMPRPDRFFPSRYWSKQIIEHERAQ |
| A0A1Y1W3K7 | 633-705 | None |
| G4TF40 | 18-99 | None |
| A0A197K102 | 1-67 | None |
| N4VLW0 | 32-125 | None |
| Q2H0H6 | 1-77 | None |
| V2WI60 | 21-86 | None |
| M5GBI7 | 57-144 | None |
| W7TT33 | 7-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.