DPCstruct | MC13624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 121 ± 17 aa |
| Standard deviation of domain lengths | 16.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1PN36 | 21-130 | VARKRRVVLIAPGEVTLENGTYHPIADSLYIDCTADALTKLEAAPLFRGKTITLRPVRHCQRVFSAAFIAHVGAIYDNDRLINELCR… |
| A0A655F0H8 | 1-90 | MLDGGSVPATPTALYIDCTADGAPQRPAKPVFDADHLTLQAVRGCQQVFSAAFIAHVEFAYEDDAVKNELCTPIPHPDCDLDWMRLM… |
| A0A2U3PTC1 | 1-135 | None |
| A0A7S2LJR9 | 1-115 | None |
| A0A4Q8UUV2 | 39-164 | None |
| A0A1B7LXF6 | 83-206 | None |
| A0A7S2LEN9 | 20-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.