DPCstruct | MC13622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 163 |
|---|---|
| Mean domain length (aa) | 222 ± 50 aa |
| Standard deviation of domain lengths | 49.64 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.53 |
| Pfam Score | 98.36 |
| Assigned Pfam label(s) | CL0220- PF01328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8M845 | 1-124 | MSPDILATAVKVASLTTDDPFSFTLDDIKLHSNIEHDASLSREDFALGDNVRFNETIFTTLANSNPGFDFYNTTSAGEVQRLRLADS… |
| N1PFG1 | 5-203 | ANHGFIPHNGKGLTQPIVTKGLADALNIGPDLANFLFAGGLLSAPQPLLGSFDLNMLDQHNFPIEHDASLSRIDTFFGNNRPFNQTI… |
| A0A395SYI7 | 19-243 | None |
| A0A176YF36 | 8-230 | None |
| G4TF47 | 52-278 | None |
| A0A4Q4YU15 | 5-183 | None |
| H0EKP0 | 1-289 | None |
| H0EZ44 | 2-155 | None |
| R9P7R7 | 178-521 | None |
| A0A4U0VEW3 | 49-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.