DPCstruct | MC13620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 252 ± 23 aa |
| Standard deviation of domain lengths | 22.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V7WZZ1 | 23-261 | ASEKPLPLETKFREAHDTLILMRHYGQTIKDPKLKQDFDRLFSDKLDRLPGDLVDQFHSLRKQYYPEKKRIIDEDSAKETVKNLKNQ… |
| N1PCT6 | 80-334 | MADEFRDSYNELFYTQLFSSEFEHVAYRNRVQDQIIGDIKNLRLDANREYNQLFKSTFLHRVDEARILTEGEQYLARHRMMALIQKL… |
| A0A349DRV5 | 340-614 | None |
| R1G201 | 906-1155 | None |
| A0A2V5JGZ2 | 7-188 | None |
| A0A538PPN9 | 869-1124 | None |
| A0A397FWL4 | 1-252 | None |
| A0A3E1NWJ2 | 104-376 | None |
| A0A3M8CLY0 | 19-280 | None |
| A0A2I1BWU2 | 33-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.