DPCstruct | MC13618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 8.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T1W6 | 10-87 | LETALAEAKIAVDLFFNNKFNEAEALMKPLATSSMYHSVGHSVFTYLEAMLTFEQQHIAAASEALKQCLNVCNRYRKK |
| A0A3B3ZVR8 | 28-121 | KCIYKTTSKTARIPHLSTALKECSTALEYFLNNHFADALALLKPWKDQSMYHAMGYCSILVMQAGMTFDPKDMDAAMTSLRDALQTC… |
| A0A7P0T9F5 | 1-97 | None |
| A0A6P4WBR5 | 85-173 | None |
| A0A0B2UU38 | 57-145 | None |
| A0A2K5KEX3 | 2-79 | None |
| A0A5K3EHH2 | 3-96 | None |
| A0A2I3TKG2 | 11-93 | None |
| A0A3B3I7K5 | 12-111 | None |
| A0A667WDB2 | 5-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.