DPCstruct | MC13617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 11.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R4WTE1 | 3-119 | EFNERLSKYDLSETQLSLIRDIRRRGKNKVAAQNCRKRKLDQILSLADEVKQMRERKQRLLHERQVLYTERHRIRTKFSQLYKHIFQ… |
| A0A3B3ZMU9 | 1-156 | MSLLDLALEEGFGEELSEKLEEHGYLDPELTRRPSQLKQLNLVRDIRRRGKNKIAAQNCRKRKMDNLQGLEKDVTMLRRRKSRLLKD… |
| A0A3Q3VQG2 | 259-384 | None |
| A0A287A5D7 | 477-613 | None |
| A0A6I8P469 | 221-355 | None |
| R7V3M6 | 244-369 | None |
| A0A2H1VRS4 | 33-180 | None |
| A0A4W4HD58 | 185-314 | None |
| A0A212FCH5 | 864-1000 | None |
| A0A3N0Y6D4 | 140-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.