DPCstruct | MC13616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 153 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.16 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0617- CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3ZLV1 | 1-160 | MCIVLCIVLCIVLLNPCCYLPCQNQGVCVRYAEDEYECDCVRTGFYGENCTVPEFWTRVRLFLRPSPGVVHFILTHFSWIWDIVNST… |
| A0A672T4H6 | 1-136 | RGICVRYGLDRYECDCTRTGFYGENCTIPEFWTRVYRLLKPSPNIVHYILTHFDWLWDIINRTFLRDWLMHKVLTVRANLIPSPPTY… |
| A0A267G0P7 | 33-183 | None |
| A0A6P7JCB2 | 17-164 | None |
| C3XRN1 | 663-858 | None |
| A0A498N273 | 5-151 | None |
| A0A7J8BGB2 | 6-165 | None |
| A0A0S7GNV5 | 17-172 | None |
| A0A670IJW4 | 1-164 | None |
| A0A091CZG8 | 323-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.