DPCstruct | MC13615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3ZLG7 | 1-84 | MSVAFPSARPRTKGEVTPQSIQKMLDENHHLIQCIMDYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSPPSHPSPTHTS |
| A0A6P5EF49 | 11-78 | NMMGGYASPTTVTTDLIQQYLDQNKQLILAILDNQNTGKVEECARNQAKLQHNLMYLAAIADSQPPQA |
| A0A7M7N6A7 | 1-81 | None |
| A0A2P2MUL4 | 3-77 | None |
| A0A6P6FYZ5 | 1-86 | None |
| A0A6S7IHZ1 | 1-100 | None |
| A0A2C9WHR9 | 2-73 | None |
| A0A453I0R8 | 1-80 | None |
| A0A454Y6U4 | 6-80 | None |
| A0A2I0TW66 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.