DPCstruct | MC13613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Standard deviation of domain lengths | 11.13 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672UCV1 | 28-100 | AGGFRKETVDRLLRLHFRDGRTRVNGDAQLLMAEMLKVFVREAAARAARQAHAEDLEKVDVEHVEKVLPQLLL |
| A0A3B3ZI66 | 17-85 | QETVNKLLSSFFKEEKTRCNSDVVVLMAEMLKIFVQEAAVRSQKQAEAEDCNQVDIEHFEKIVPQLLLD |
| A0A017SPX8 | 115-198 | None |
| A0A1Q3A3L7 | 36-121 | None |
| A0A3Q7FRS4 | 109-163 | None |
| G5BJ89 | 5-78 | None |
| G4MKQ9 | 200-273 | None |
| E9GIB9 | 11-87 | None |
| A0A7R9H7M1 | 2-70 | None |
| A0A819ZSJ2 | 107-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.