DPCstruct | MC13611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 257 ± 50 aa |
| Standard deviation of domain lengths | 50.11 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4SBC8 | 3-291 | QESIIRYWHAVELLQPQSAPKLKKRSNRYEAFIHDTPIQRPLLPWTPESIVSKQKLPKKRIWSHTLYAHLYDSRLVAEKLDAMYGAD… |
| K8XEX2 | 8-282 | KADVVAFWRAIELFSPQTVPKIDRFDTHAPVERVTDGKPLPWEAGHRLHGRSTRRGYQRQHIVYLGVYRIDDVWMAVDDILDPGTEN… |
| A0A529M875 | 122-412 | None |
| A0A512C1T4 | 142-407 | None |
| A0A2E0R129 | 131-289 | None |
| I0GU00 | 5-309 | None |
| U2CXI4 | 4-286 | None |
| A0A368NKC9 | 120-410 | None |
| A0A227KGB6 | 11-289 | None |
| N2AKD5 | 1-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.