DPCstruct | MC13610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 92 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.02 |
| Pfam Score | 93.76 |
| Assigned Pfam label(s) | PF18913- CL0171- CL0224- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7Q7W9 | 31-117 | LAVAGRIIARASLSLYPLYPADAGKADGRLRLQDEAAPMAFIAEQAGGRASTGRERSMTIPPATPHQRVPLLIGSAEDVAPAEDFSA |
| A0A4U9D7N7 | 1-51 | MAFLAEQAGGKASDGKERILDIVPVSLHQRRSFFVGNNHMVEDVENLIKEF |
| A0A5N6Q932 | 382-477 | None |
| M7Z581 | 218-317 | None |
| A0A178EDW1 | 505-605 | None |
| A0A6V7PUW2 | 412-490 | None |
| A0A2H4SAF6 | 218-332 | None |
| A0A6A4JS62 | 1007-1099 | None |
| A0A1E3H0U0 | 80-171 | None |
| A0A1E7FDZ3 | 365-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.