DPCstruct | MC13609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 105 ± 16 aa |
| Standard deviation of domain lengths | 15.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z4HS65 | 2-93 | VQIICLANSKKYGDRCIAGIEITTGKWIRPFSNLEYGQIPVNMCLVDDEEPKSLDILEIPLAATGLGYEYENRAILHGKWQKIGQAT… |
| A0A398C399 | 4-100 | RVVILTKSDKHNGFCVAGRDINSGEWVRLENSRGVIDSKDLITKDGYECRELDIIEIELLSEKSDVEHQPENVLIDEQCYVQLFGRM… |
| A0A2H9QUI5 | 1-112 | None |
| A0A5P8E556 | 1-111 | None |
| A0A6L7S4R5 | 2-105 | None |
| A0A0S7BRD6 | 36-130 | None |
| A0A2M7JZ71 | 2-121 | None |
| A0A7X9DDX7 | 1-96 | None |
| A0A7X8LM92 | 2-102 | None |
| W4VMI3 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.