DPCstruct | MC13608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 259 ± 63 aa |
| Standard deviation of domain lengths | 63.22 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.35 |
| Pfam Score | 73.61 |
| Assigned Pfam label(s) | PF08455- PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5NA93 | 3-228 | FNINLNVVKSKNNLEIARRYHHYDNVESMHITLKDDLYHIDAIVSVFNHMQKCSLEIKDNKIVSYKCACPFNDQDSMCGHLGAVIMK… |
| A0A139QK33 | 5-282 | IPGKIRTEGTTLYEAGKIEILKVKDRMIYSRVENHNLRYSLDDEAIFCACDFFQKKKYCAHIAGLEYFLKNDPEGKVVLANLEEEQT… |
| A0A1M4ZHP2 | 13-316 | None |
| F9P776 | 1-192 | None |
| A0A449BBU7 | 465-728 | None |
| A0A150NQ15 | 5-195 | None |
| T2RFQ1 | 3-176 | None |
| R9RCN0 | 13-297 | None |
| A0A534Q9Q8 | 26-319 | None |
| A0A6P1ML06 | 41-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.