DPCstruct | MC13606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Standard deviation of domain lengths | 8.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844W5P8 | 1-57 | KYVQFSDHIIGPRKSQHFHIFMGNESQEALLKEMDNWPTYYPYALHKEQIVDEMLHH |
| A0A139QEQ6 | 2-69 | FETTDKDAGKYKYVQFSDHNIAPTKAAHFHIFYGGESQEALFNELENWPTYYPTKLSGQEIAQEMLAH |
| G6ENA9 | 291-373 | None |
| A0A1F1B2B7 | 89-164 | None |
| A0A417XJI9 | 56-136 | None |
| A0A1E5GF56 | 14-81 | None |
| A0A3S9HAN5 | 207-286 | None |
| A0A3N5CGQ1 | 181-270 | None |
| A0A6A0BCA8 | 421-501 | None |
| A0A2Z6G5R5 | 14-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.