DPCstruct | MC13602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 259 ± 34 aa |
| Standard deviation of domain lengths | 34.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11855 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6VGV3 | 259-551 | VSGLPIEFARVGEVVEALQEQLRADFRADARPAGEIVADFLTRADDLTTATPEGRAFEGAFNLLDDDALLDQLRTDITSLVEHPDIA… |
| A0A645D2M4 | 2-215 | DAVLDRDFAADLPLAGIAFLRQYLTTLQGESAQVRGTLTDLSRSLRRFVETQEYREQQRLATAINSSEQALMGLLHSLPTTHKIGVG… |
| A0A855IFJ5 | 2-188 | None |
| A0A7J5BNZ3 | 377-633 | None |
| R5EYS2 | 32-297 | None |
| A0A5C9BP90 | 931-1189 | None |
| A0A1S9AQ05 | 186-476 | None |
| A0A0P8CCP2 | 1-261 | None |
| A0A5Q2FEZ1 | 190-448 | None |
| A0A1V4GM32 | 83-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.