DPCstruct | MC1360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 112 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4XEW3 | 244-354 | TLIEFRIVDRKGEKPGFWRTLVGDDATKQFFVVVEAVVDEKTVNWAVRDADSGKVVSDAKFGLRVDEKTFAELSADKKDDGRIDKMV… |
| A0A699Y9P8 | 56-167 | QTLVYRIVNRDDERTGVWRYNEKANGGRNYYLVTEALDEAGNAAELPIRNEETGKEERVSVFAVRVPEATYNRVAADKQDNGIIEDD… |
| A0A7Y3G993 | 194-305 | None |
| A0A1B8TAV8 | 362-477 | None |
| A0A6M1SWI1 | 128-240 | None |
| A0A6I1JD10 | 43-149 | None |
| A0A246GTH7 | 52-174 | None |
| A0A7W4SM81 | 280-388 | None |
| A0A7W0XLT3 | 157-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.