DPCstruct | MC136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 267 ± 43 aa |
| Standard deviation of domain lengths | 43.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8D842 | 239-454 | GICNTKYFYKLFKKLPHIFPKISQDDLKLLHDNLKKYIKIRNLSEVYHDYSIYWDDEVTKKAQITILLLRDSGVEILTLETIPSISF… |
| A0A842VBS1 | 7-228 | RYRFYAPQEIADAIRAVQRFKGWKFAKEEGYHEDWNEEYMKGYHVVNGLIRTLGFDPLTFTILEDKIFERKFIKKESYNRHHFRQVK… |
| A0A0F9QDP6 | 667-984 | None |
| A0A0F9NUM1 | 258-532 | None |
| A0A842SYS1 | 10-287 | None |
| A0A7J2PL12 | 1-223 | None |
| A0A7C1YW63 | 390-675 | None |
| A0A7K4GLC3 | 148-373 | None |
| A0A842VDY1 | 696-970 | None |
| A0A7C1Z5E6 | 14-364 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.