DPCstruct | MC13599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9JII3 | 386-482 | RAKKNVLNFLRKYPQEYDCSSYQETATTILAGIKKNGKPIKIVVRPSDGDKIYIYYQSELDTMDYEDYELWVDNNQDEPRQLTFGKL… |
| A0A2S5CFJ5 | 1-92 | MVKHLETLEKYDCSDWEELAPTVIGGIKKEGRSIHIVIRPSDNGQVIIYYGYEKDVLDTADAELWIDNGKDTPNHLTLGKILKKTGI… |
| A0A2S7WQL8 | 121-219 | None |
| A0A4Q2LVZ5 | 90-194 | None |
| A0A844LPP9 | 202-317 | None |
| A0A1E3KWT7 | 275-372 | None |
| E4TNG7 | 213-309 | None |
| A0A162TJE6 | 868-958 | None |
| A0A0F2J773 | 206-296 | None |
| A0A359LVK7 | 601-696 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.