DPCstruct | MC13598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 2.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645CR05 | 8-72 | TKFCDRCHTSLEGKTRQMSRFNTDCLCPECTAEERQHPDYSKAVDAEMEAVKHGDYNFPGVGWPS |
| A0A833GP79 | 5-68 | PTHCERCGADLAKVSSIMSKFNQDTICSPCKARERAHPGYREADEAEIAAVRAGDCNFPGVGCP |
| I4D3E7 | 13-71 | None |
| A0A661E1A6 | 29-93 | None |
| A0A3S0UGK7 | 1-63 | None |
| A0A3P3T9Z2 | 61-123 | None |
| A0A5C9BKP1 | 5-62 | None |
| A0A1U7M5V2 | 43-108 | None |
| A0A133U9G6 | 3-59 | None |
| A0A140GR85 | 2-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.