DPCstruct | MC13597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7H2N1 | 130-196 | YSAITIPYEFLPLPQKGEKGFGYDRSGTKVCEAEVLQVRTSPAFDRTNLLTMKVPADMVMRARFYKA |
| A0A645CQQ8 | 1-66 | MAFPYEYHPVPKAGDRVRAVDRKGEFRCEATVVKVLSPAGFDHTPLVTIEIPKELADEVRSIERER |
| A0A355BHR6 | 1-59 | None |
| A0A645HR98 | 18-88 | None |
| A0A7V8D8V4 | 72-137 | None |
| A0A847AG73 | 72-136 | None |
| A0A7J4EF13 | 55-116 | None |
| A0A7V6WIQ3 | 2-73 | None |
| A0A0F9GMU2 | 112-180 | None |
| A0A7C1BEL1 | 90-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.