DPCstruct | MC13590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 427 ± 82 aa |
| Standard deviation of domain lengths | 81.95 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4AWV7 | 103-476 | LSLADIVQSEPMLTTIELLKAAADADASRKRQVHKALTMMASMSLGSVKETRNKKTDLVGRFLQLHILGLMTRFTDVINDSISIHPQ… |
| A0A821QDX4 | 1-382 | MSVLNLIKRHFRIILTEFLLQYCCDPEKVLNACRYLACHDPDVSTPQGSLSMSTTQIADFLNPKFLGVLAYFDHKLVNAKVALSVKR… |
| A0A146FHL7 | 13-548 | None |
| A0A452ZIN2 | 148-588 | None |
| A0A5N5SQF6 | 29-433 | None |
| A0A2I0AEE5 | 108-575 | None |
| A0A7G2C960 | 313-929 | None |
| A0A453TAB3 | 3-348 | None |
| A0A0R3TCN4 | 12-568 | None |
| A0A5D3BHE6 | 1-447 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.