DPCstruct | MC1359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 148 ± 14 aa |
| Standard deviation of domain lengths | 13.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S6EXB8 | 2-146 | PPVEVIQSCKNNNPANKSVLMTEIEGIGYNKDSEPNCKNQFDTEIGGKLYGSATCDDKPYLIIADHKIKVESANNYSTNPAIKPTTA… |
| A0A484ZE83 | 14-171 | IGFAQPTQAPEESAMLSCLLAKSSGEDTRYKNISVRNVRIRGDNSSNGMSYSFPYGEKMLGYFEKFGKGDVLFNEKNYSVQQSLPLT… |
| A0A3E1RUB3 | 5-147 | None |
| A0A4T1FRL6 | 15-170 | None |
| A0A8A9QNB7 | 1-162 | None |
| A0A848FVB6 | 31-174 | None |
| A0A6L6Q600 | 2-125 | None |
| A0A364LF54 | 7-141 | None |
| A0A0F0DKN8 | 3-141 | None |
| Q5ZSZ5 | 21-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.