DPCstruct | MC13588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 156 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4WNF6 | 122-246 | GQVATVTRHLPPSGPFGAYRDLKRHWKNMYGYRLPEEEPPHYVNVNFRLVGPQLFTYPPLCLRNGSPVFLARPAPRPILTALLRDLH… |
| A0A674GC79 | 208-364 | GQIINISHIIPPESPFRSYKDFQMHWKSLYGYILPEDLEETKIYLSVYFKPIGERFFTYPLNCIRRQPVQYFPRTDAESVVSSFLSD… |
| A0A3B4AAZ4 | 143-282 | None |
| C5LHY8 | 34-185 | None |
| B7P1B0 | 1-177 | None |
| A0A6F9D8R1 | 1-152 | None |
| A0A3Q2CN16 | 110-303 | None |
| A0A3Q2PCP4 | 74-233 | None |
| A0A2I4CYN2 | 1-162 | None |
| S4R619 | 213-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.