DPCstruct | MC13587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 148 ± 14 aa |
| Standard deviation of domain lengths | 13.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A037ZRI1 | 8-157 | TLIAATLALSPVGARPVLADKNSDTAAAVLLGALAIYGISQASKKDKKKPEPTPEPVVATHTHTFTSHHARRYQLVRYGHGILPLSC… |
| A0A1X6YPF5 | 205-332 | EERRRAEARARLEAQGSPVAPAPEALPPIPRDEVTPDLLRDWKPATTSAQTLPETTTPVATGEIPFACLRRQQSGFESASLVDGDCL… |
| A0A7W6GT93 | 26-178 | None |
| V7EMY8 | 17-164 | None |
| A0A4S3MEV4 | 52-216 | None |
| A0A2N3BRW3 | 5-155 | None |
| A0A2U2CII7 | 1-134 | None |
| A0A5Q4DLY6 | 4-128 | None |
| A0A058ZL07 | 20-160 | None |
| A0A7G2TS05 | 6-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.