DPCstruct | MC13586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 145 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090WF28 | 106-251 | YPDKILIEREEDYHTHYLGELNDGRLFFGYNTFIFPNGFQAENWQESRLEYVVVYLFDNNGEFLEVLYKFIGKTKDVQIGESERLLL… |
| A0A037ZFJ6 | 1-160 | MDESSADAVEGTDVTQTGFPLAPDDEHLQHVGKTKQGNGYWIDFQLAVEDGKVRDFVTAYVFDKEGHLISCEVINCGLRGDADCRTA… |
| A0A2W4HYF9 | 175-345 | None |
| A0A0Q8WH14 | 3-136 | None |
| A0A1N6T1R7 | 1-133 | None |
| A0A0H2KIH6 | 43-173 | None |
| A0A327NRW8 | 79-225 | None |
| A0A1V5MBB3 | 30-162 | None |
| A0A1I4CK34 | 83-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.