DPCstruct | MC1358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 188 ± 31 aa |
| Standard deviation of domain lengths | 30.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3GBC7 | 2-232 | TNKKTTAAPLPLWQYWRGLGGWNFYFLVKFALLWAGYLNFHPMLNLVFLAFLLVPIPREKLHRIRHWIAIPLGFALFWHDTWLPGPE… |
| A0A484ZBL0 | 1-191 | MNKENISSKTESSDKKLWTNWRGLRGWNYYFLIKFALLWGGYLNFHPLENLVFIAFLLFPLPEGLLRKTWDWIAFPVGIILFYYDTW… |
| A0A090SEX6 | 2-157 | None |
| A0A376TYV5 | 1-192 | None |
| A0A381GW57 | 1-144 | None |
| A0A377ND30 | 1-177 | None |
| F4N2L0 | 1-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.