DPCstruct | MC13577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 3.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 68.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453K6S4 | 1-57 | EAGGVVTDASGNDLDFSKGRFLDVDTGIIATNKQLMPSLLKSVQEAIKEKSQAPSPL |
| A0A453QNV8 | 58-111 | IVVTEAGGVVKDASGNDLDFSKGRYLVRDTGIIATNKQLMPSVLKCVQEAIKEK |
| A0A0K9R681 | 672-725 | None |
| A0A2P5XWW7 | 244-293 | None |
| A0A2P5XJZ6 | 208-262 | None |
| B8BNH9 | 571-626 | None |
| A0A0A9HKK1 | 1-46 | None |
| A0A834GQU6 | 9-63 | None |
| A0A444E4W3 | 49-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.