DPCstruct | MC13576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 129 ± 22 aa |
| Standard deviation of domain lengths | 22.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 66.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452XUG2 | 1-88 | AAPPASPVAAPAPGARAGAKGELEAFLEVVPARMRRELALHPEVWELVEVVMDLGRRPLARFPSGDWVISDQPVTADDLRQAVSKVGN |
| A0A453K5Z7 | 1-118 | MTPSPARILIFLLPTPSLIPPPPVRRPHRALAGTARCAPEAVAGGGFVVIEDDLSELLQILPRDLRDNLQNEPRRDQLLEVILDLGR… |
| A0A835UIQ5 | 39-133 | None |
| A0A843UZ05 | 58-196 | None |
| A0A1Z4J9N7 | 11-98 | None |
| A0A444XUV4 | 38-165 | None |
| A0A7S3BXZ9 | 1-127 | None |
| A0A7G2DZT1 | 196-326 | None |
| A0A5N6NV37 | 1-167 | None |
| A0A250XJC6 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.