DPCstruct | MC13575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287K038 | 9-90 | QFVAKEEMAIDEAELEPLEFAEKMHTQQELQQQQLEMLVQIRKYSPESQSDILETLRKQLEHADFDPSASVLTPEQIKGIVQ |
| A0A453K5N6 | 2-78 | AIDEVELEPLEFAEKMHTQQELQQQQLEMLVQILKHCSESQSVILETLQRQLESADLDTSLSIFTPEQIQGIVEKYS |
| A0A830D8Z8 | 1-69 | None |
| A0A835KMQ2 | 82-163 | None |
| A0A3S3MPC3 | 183-263 | None |
| A0A2P6S6H9 | 47-153 | None |
| A0A2P5Y532 | 179-265 | None |
| A0A4Y1R9B9 | 96-171 | None |
| A0A3B5Y4A7 | 78-157 | None |
| A0A2H5Q9Z3 | 219-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.