DPCstruct | MC1357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4WLC6 | 1-93 | MIIEFSNQLQSDAHTQFQSWRRQNPNGYFLNCKTRKSVMLHTSPCPHYGDTEWQSSDFNQSLTKTPKVCSPEQPELKQWATEHDATI… |
| A0A2C6DMZ7 | 4-105 | GCIVFNETEGIDTDKHYIAWINANKNGYVLSIPKNYRTISKLFLSKTTRIHRVNCYLISKYSKFQQSSSFTGKKYFKICSTNQSDLT… |
| A0A7Z7I9T3 | 90-212 | None |
| A0A845F4N6 | 1-90 | None |
| A0A6B0Y5E3 | 140-233 | None |
| A0A6I1QV02 | 169-263 | None |
| A0A420E8M9 | 3-97 | None |
| A0A810P1H3 | 19-119 | None |
| A0A172UNM1 | 97-192 | None |
| A0A840DMX1 | 123-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.