DPCstruct | MC13568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 152 ± 13 aa |
| Standard deviation of domain lengths | 13.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 87.78 |
| Assigned Pfam label(s) | CL0616- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9KWW0 | 79-229 | MDHGSDHSFSEVLWVCVNLFSDVQVKMSHKIIMLFTNEDDPHRNDSTKASQARTKASDLRDTGIFLELMHLKKPGGFDISLFYRDII… |
| A0A453JQ59 | 1-172 | VQDSFMNNIGSRYGITSGSRENTLYNALWVAQALLRKGSVKTVSKRILIFTNEDDPFGGITGAAKTDMIRTTIQRAKDAQDLGLSIE… |
| A0A162D8N2 | 12-159 | None |
| A0A3R7B1H0 | 129-264 | None |
| H3GFX6 | 402-571 | None |
| A0A0J8AZ40 | 1-141 | None |
| A0A4Z2FCY8 | 3-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.