DPCstruct | MC13567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 101 ± 1 aa |
| Standard deviation of domain lengths | 1.12 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 78.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 62.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446RV99 | 1-102 | MAPHYQATTLIASPSYPDAITWSSDNLVAVASGHIVTILNPAALDGPRGLVVLRPRDPFPIGVVNREDLFEPSLVPTSLARDTEPCA… |
| A0A453JID8 | 1-102 | MAPHYQATTLIASPSYPDAITWSSDNLVAVASGHIVTILNPAALDGPRGLVVLRPRDPFPIGVVSREDLFEPSLVPTSLARDTEPCA… |
| A0A1D6GED9 | 1-100 | None |
| A0A6S7NS16 | 54-155 | None |
| A0A438HX68 | 1-100 | None |
| W1NVR0 | 1-102 | None |
| A0A835Q6Y5 | 6-106 | None |
| A0A0B2QQE6 | 9-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.