DPCstruct | MC13566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 274 ± 26 aa |
| Standard deviation of domain lengths | 25.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 52.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6QTT8 | 150-457 | KLEIKRLRLGLSAAERDQALLSIGVIPATLDPNRLIDYSYLLKLSSLADNLALLGHTVLEDRANASIGLEKGSEHAIDFWNISENDE… |
| A0A453JGE6 | 6-259 | FEQMMKLEIKRLYLDLSAAERDRALLSIGVIPATVDPNRSVDYSYLLKLSSLTDKLALLGHSVFEDRANASIGLEKVNSHAVDFWNI… |
| A0A2G5EQ24 | 989-1250 | None |
| A0A834Z897 | 272-596 | None |
| A0A2G3BRL2 | 8-272 | None |
| A0A1D6QTT1 | 623-891 | None |
| A0A6V7NJJ2 | 2-264 | None |
| K7K890 | 972-1232 | None |
| A0A1S4CIC9 | 428-693 | None |
| A0A7J6WHE0 | 2-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.