DPCstruct | MC13565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804RKH1 | 354-409 | VTHFVGCKPCGKFGDYPVERCLKNMDRAFNFGDNQILQMYGFTHKSLASRRVKRIR |
| A0A453JCX6 | 1-59 | FVTHFTGCNPCGGRPNEIYSNESCAEGMRRALNLADDQVLRAYGFRHAGPLKDDVRPLL |
| A0A2U1NDK6 | 467-521 | None |
| A0A3L6QKA5 | 210-282 | None |
| A0A834LEJ0 | 631-705 | None |
| A0A426Z821 | 49-114 | None |
| A0A6P4P0R6 | 110-176 | None |
| A0A396IE49 | 822-884 | None |
| A0A540KCC0 | 33-102 | None |
| A0A444CBZ2 | 116-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.