DPCstruct | MC13564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 358 ± 47 aa |
| Standard deviation of domain lengths | 46.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 44.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6VUC8 | 1-406 | MQVLHSLYNFPKRFIEYYHSPDACITCDDGDLEAWEFEGQRWARLIFIVMTKEHHMEFIFKFLRNYGVNICKQRNHLEWLPLKFLIL… |
| A0A453JBK0 | 21-345 | NTLLDELIDFPTTFMKHTGIEGSYLYDDEDVGAWEAEARRWARTLLLVTSEEHHFKQIFTFLEKCGNKLSEHSSTRKCADVKFFIII… |
| A0A287Q433 | 459-766 | None |
| A0A833XUL7 | 10-373 | None |
| A0A834YCS6 | 8-305 | None |
| A0A453JBL7 | 21-395 | None |
| A0A2G2XLL8 | 628-1060 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.